PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g45325.1.p
Common NameBRADI_4g45325
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 239aa    MW: 26234.4 Da    PI: 8.8911
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g45325.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.57.1e-21666257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      ++R+++t+eql +Lee++++  r+p+a+e+++++++l    +++ ++V++WFqN++a+e++
  Bradi4g45325.1.p  6 STRWCPTPEQLMILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 66
                      58*****************99**************************************97 PP

2Wus_type_Homeobox121.24.2e-39567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+PtpeQ++iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+
   Bradi4g45325.1.p  5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 67
                       689***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.463267IPR001356Homeobox domain
SMARTSM003896.8E-6471IPR001356Homeobox domain
SuperFamilySSF466899.84E-12470IPR009057Homeodomain-like
CDDcd000862.12E-4560No hitNo description
PfamPF000461.5E-18666IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-7866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH  60
KARERQRLRR RLCARHQQQP PASSPSPVTP PPPNASAGAV NVMHPAVMQL HHHHHHHPYA  120
TTTTCSFMPP QGYSHQQQQD AGGAVPVSGL EFPAAGGGKA HQQQQEWTTQ QQQQMMMMEN  180
SNNINAGGSS GAGGMTPPPW PCCRPLRTLE LFPTKSTGGG LRDECSSSKS SSCSTSTN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5365781e-108AJ536578.1 Zea mays mRNA for homeodomain transcription factor (prs gene).
GenBankBT0661201e-108BT066120.1 Zea mays full-length cDNA clone ZM_BFb0350F05 mRNA, complete cds.
GenBankJX4699421e-108JX469942.1 Zea mays subsp. mays clone UT3202 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238840.16e-75PREDICTED: WUSCHEL-related homeobox 3-like
SwissprotQ70UV12e-59WOX3A_MAIZE; WUSCHEL-related homeobox 3A
TrEMBLA0A0Q3LJN31e-178A0A0Q3LJN3_BRADI; Uncharacterized protein
STRINGMLOC_7772.12e-77(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Representative plantOGRP55801121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-34WOX family protein